PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1105
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 104aa    MW: 11893.7 Da    PI: 10.6635
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1105genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.58e-104498156
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56
                 e+e k+ + k+kNR++A +sR+R ++ +   eekv++L +eN aL k+l +l+  +
  Gh_A01G1105 44 EAEQKKRKNKIKNRISAAKSRARSQEHTRFPEEKVEQLRNEN-ALLKKLLSLEAAA 98
                 67899*************************************.5777888887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.6E-104092No hitNo description
PfamPF001704.8E-74493IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.9794690IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.25E-74893No hitNo description
PROSITE patternPS0003605166IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MLEKRSRMQV LAADAPSGSG ELLIMNDLPV YKRGRNKIQE AIEEAEQKKR KNKIKNRISA  60
AKSRARSQEH TRFPEEKVEQ LRNENALLKK LLSLEAAAAE RLPE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.152391e-101boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443102.19e-47PREDICTED: uncharacterized protein LOC105767988 isoform X2
RefseqXP_012443103.17e-47PREDICTED: uncharacterized protein LOC105767988 isoform X3
TrEMBLA0A0D2TLX22e-46A0A0D2TLX2_G